- HID1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84075
- This antibody was developed against Recombinant Protein corresponding to amino acids: RPSTSSASGQ WSPTPEWVLS WKSKLPLQTI MRLLQVLVPQ VEKICIDKGL TDESEILRFL QHGTLVGLLP VPHPILIRKY QANSGTAM
- Human
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- HID1
- 17orf28, C17orf28, DEE105, DMC1, HID-1
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- HID1 domain containing
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Specifications/Features
Available conjugates: Unconjugated